GL Biochem (Shanghai) Ltd Contact  
Company Name:GL Biochem (Shanghai) Ltd
Tel:86-21-61263452 (tel), 86-13641803416(mobile)
Fax:86-21-61263399
Email:ymbetter@glbiochem.com
WebSite:www.glschina.com
Product Total:9560
CB Index:64
Nationality:CHINA
      GL Biochem (Shanghai) Ltd. is dedicated to the research, development, manufacture and marketing of diverse biochemicals and fine chemicals, especially peptide, peptide reagents and related products.   Featured Products Peptide coupling reagents: BOP reagent, HBTU, HOBt, TBTU Fmoc-amino acids, Boc-Amino Acids, Z-Amino Acids Protecting reagents: Fmoc-Cl, Fmoc-OSu Linkers for solid phase synthesis: HMP linker, DHP linker, Rink amide linker Unusual amino acids: Homo-tyrosine, DL-m-tyrosine, Nal, Pal, 4-Cl-Phe-OH Generic Peptide: Octreotide, Leuprolide cGMP Peptide Featured Services Custom Organic Synthesis Custom Peptide Synthesis Contract Research With well trained technical staff and state-of-the-art facilities and equipment, such as 300 MHz NMR, LC-MS, IR, Chiral & RP HPLC, High Pressure Hydrogenator ,96-well peptide synthesizer, 106-well peptide synthesizer and Microwave Peptide Synthesizer, GL Biochem possesses powerful research and development capabilities and has the systems and processes in place to ensure that all products are of the highest quality. GL Biochem has a state-of-the-art 35,000 sq.meter manufacturing facility for the production of peptide reagents and peptide. The facility has a wide range of reactors with an annual capacity of 100MT for peptide reagents and 120kg for cGMP peptides. Moreover, we have equipped our plant with state-of-the-art equipment, including over 100 preparative HPLC and analytical HPLC system. At present, the company employs almost 1000 staff, including over 350 chemists directly involved in peptide synthesis and over 150 technicians in HPLC purification. In addition to having well established, manual synthesis techniques, GL Biochem also has millligram scale Automated Multiple Peptide Synthesizers to support customers in peptidomimetics and drug discovery study. To our knowledge, GL Biochem possesses the largest state-of-the-art custom peptides facility in the world.
GL Biochem (Shanghai) Ltd Sales Network
Company Name:Shanghai GL Peptide Ltd
Tel:86-21-61263385
Fax:86-21-61263399
Email:ymbetter@glbiochem
WebSite:http://www.glbiochem.com
Nationality:CHINA
GL Biochem (Shanghai) Ltd Product List
Product Total:9560 Product Page:
32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96
Product Name MF CAS Details
ACTH (4-9);MEHFRW C42H56N12O9S Details
ACTH (6-24), human C111H175N35O21 Details
ACTH (7-38), human;FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE C167H257N47O46 68563-24-6 Details
Tyr-ACTH (4-10) C53H68N14O12S 131374-17-9 Details
Activated Protein C (390-404), human??;YGVYTKVSRYLDWIH C91H130N22O23 146340-20-7 Details
Activity - Dependent Neurotrophic Factor, ADNF Details
Activity-Dependent Neurotrophic Factor-14 177159-38-5 Details
Acyl Carrier Protein (65-74) (acid) C47H74N12O16 Details
Acyl Carrier Protein (65-74) (amide) C47H75N13O15 Details
Adamtsostatin-16 Details
Adamtsostatin-18 Details
Adipokinetic Hormone, Locusta Migratoria;Pyr-LNFSAGW-NH2 C43H57N11O11 Details
AKH, Adipokinetic Hormone-2, Schistocerca gregaria;Pyr-LNFSTGW-NH2 C44H59N11O12 Details
Adipophilin??;SVASTITGV Details
ADR1-derived peptide??;LKKLTRRASFSGQ-OH Details
Adrenomedullin (1-52), porcine;YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2(Disulfidebridge:16-21) Details
Adrenomedullin (1-12), human;YRQSMNNFQGLR C64H100N22O19S Details
Adrenomedullin (11-50), rat;STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2(Disulfidebridge:4-9) 163648-32-6 Details
Adrenomedullin (1-50), rat;YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2(Disulfidebridge:14-19) C242H379N77O75S5 159964-38-2 Details
Adrenomedullin (1-52), human;YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2(Disulfidebridge:16-21) C264H406N80O77S3 148498-78-6 Details
Adrenomedullin (26-52), human;LAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 C139H216N40O42 Details
Metorphamide C44H69N15O9S 88377-68-8 Details
Metorphamide (free acid) C44H68N14O10S 88866-92-6 Details
AF-1 C45H69N13O10 130092-56-7 Details
Agouti-related Protein (AGRP) (83-132) Amide (human) Details
Agouti-Related Protein (AGRP)(25-51)(Human) Details
Agouti-Related Protein (AGRP)(54-82)(Human) Details
AGRP (25-51);LAPMEGIRRPDQALLPELPGLGLRAPL Details
AGRP (54-82);TTAEQAEEDLLQEAQALAEVLDLQDREPR Details
α-Helical CRF (12-41) 158535-55-8 Details
Allatostatin VI;YPQEHRFSFGL-NH2 C65H90N18O16 Details
Alloferon 1 C52H76N22O16 347884-61-1 Details
α-Mating Factor;WHWLQLKPGQPMY C82H114N20O17S 59401-28-4 Details
alpha-Factor Mating Pheromone, yeast - Amide Details
Alternate Syntide??;PLSRTLSVSSLPGL-NH2 Details
a-Mating Factor: 1-6 C45H59N11O8 65418-88-4 Details
Amylin (20-29), human;SNNFGAILSS C43H68N12O16 118068-30-7 Details
Amylin (IAPP)(Feline) C165H270N52O54S2 Details
Amylin, human, amide Details
Amylin (1-37), rat;KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2(Disulfidebridge:2-7) C167H272N52O53S2 Details
β-Amyloid (17-42) Details
Amyloid P Component (33-38) amide C37H56N10O7S 180387-76-2 Details
Amyloid Precursor N-Terminal Peptide C92H144N28O32S2 Details
Amyloid β-Protein (20-29) Details
Amyloid β-Protein (6-20) Details
α-Neo-Endorphin (1-7) C40H61N11O9 Details
α-Neo-Endorphin Analog C66H102N20O13 Details
α-Neo-Endorphin, porcine C60H89N15O13 Details
Angiotensin II Receptor, AT2, Amino Terminal Fragment??;MKDNFSFAATSRNITSS Details
Angiotensin III (Human) C46H66N12O9 12687-51-3 Details
Anorexigenic Peptide C13H17N5O5 69275-10-1 Details
ANP: 1-11, rat C49H84N20O15S Details
ANP: 8-30, frog C97H155N33O33S3 Details
Antennapedia Heptapeptide Details
Antennapedia Leader Peptide Details
Antennapedia Peptide, acid;RQIKIWFQNRRMKWKK C104H168N34O20S 329306-46-9 Details
Antho-Rwamide I;Pyr-SLRW-NH2 C31H46N10O7 114056-25-6 Details
Antho-Rwamide II C32H48N10O8 Details
Anti-Inflammatory Peptide 1;MQMKKVLDS C45H82N12O14S2 118850-71-8 Details
Anti-Inflammatory Peptide 2;HDMNKVLDL C46H77N13O15S 118850-72-9 Details
Anti-Inflammatory Peptide 3;MQMNKVLDS C43H76N12O15S2 118850-73-0 Details
Antioxidant peptide A C27H47N11O5S Details
Antioxidant peptide B;TRNYYVRAVL C57H91N17O15 Details
Apelin-36, human;H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH C184H297N69O43S 252642-12-9 Details
Atrial Natriuretic Peptide (1-24), frog;SSDCFGSRIDRIGAQSGMGCGRRF(Disulfidebridge:4-20) C103H165N37O34S3 Details
Atrial Natriuretic Peptide (1-29), chicken;MMRDSGCFGRRIDRIGSLSGMGCNGSRKN(Disulfidebridge:7-23) C124H211N47O40S5 118691-45-5 Details
Atrial Natriuretic Peptide: 5-28, human C106H163N35O34S3 Details
Atrial Natriuretic Peptide (ANP)(1-28) Alpha (Human, Ovine, Canine) Details
Atrial Natriuretic Peptide Substrate, [pS6] ANF 1-28;SLRRS-pS-CFGGRIDRIGAQSGLGCNSFRY(Disulfidebridge7-23) Details
Atrial Natriuretic Polypeptide (5-27), human C97H154N34O32S3 Details
Atriopeptin I C83H135N29O30S2 98084-68-5 Details
Atriopeptin II 98084-69-6 Details
Autocamtide-2 [KKALRRQETVDAL];KKALRRQETVDAL C65H118N22O20 129198-88-5 Details
BAM-18P;YGGFMRRVGRPEWWMDYQ C107H148N30O26S2 Details
BAM-12P, Bovine Adrenal Medulla Docosapeptide;YGGFMRRVGRPE C62H97N21O16S 75513-71-2 Details
BAM-22P C130H184N38O31S2 76622-26-9 Details
b-Amyloid: 10-35, amide? Details
β-Amyloid (17-40) Details
Band 3 Protein (547-553) (human) C41H63N11O11 167095-71-8 Details
Band 3 Protein (824-829) (human) C37H65N11O8 158475-15-1 Details
Bax-BH3??;KKLSECLKRIGDELDS Details
Bax-BH3L63A??;KKLSECAKRIGDELDS Details
β-Casomorphin (1-3) C23H27N3O5 72122-59-9 Details
β-Casomorphin (1-3) amide C23H28N4O4 80705-23-3 Details
β-Casomorphin (1-4), amide (bovine) C28H35N5O5 Details
β-Casomorphin (1-4) (bovine) C28H34N4O6 74171-19-0 Details
β-Casomorphin (1-5) amide (bovine) C30H38N6O6 83936-21-4 Details
β-Casomorphin (1-5) (bovine) C30H37N5O7 72122-63-5 Details
β-Casomorphin (1-6), bovine;YPFPGP C35H44N6O8 Details
β-Casomorphin (1-7), bovine;YPFPGPI C41H55N7O9 72122-62-4 Details
Beacon (30-73) Details
Beacon (47-73) Details
b-Endorphin: 6-31, human Details
b-Endorphin, camel C155H250N42O44S Details
b-Endorphin, human C158H251N39O46S1 61214-51-5 Details
b-Endorphin, porcine Details
β-Endorphin, rat;YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ C157H254N42O44S 77367-63-6 Details
b-Endorphin: 1-27, camel, bovine, ovine Details
b-Endorphin: 1-27, human Details
b-Endorphin: 1-5 +: 16-31, human Details
32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96